Lineage for d2ddia1 (2ddi A:8-62)

  1. Root: SCOPe 2.06
  2. 2256768Class g: Small proteins [56992] (94 folds)
  3. 2259419Fold g.8: BPTI-like [57361] (1 superfamily)
    disulfide-rich alpha+beta fold
  4. 2259420Superfamily g.8.1: BPTI-like [57362] (4 families) (S)
  5. 2259689Family g.8.1.0: automated matches [191505] (1 protein)
    not a true family
  6. 2259690Protein automated matches [190829] (11 species)
    not a true protein
  7. 2259716Species Human (Homo sapiens) [TaxId:9606] [188132] (8 PDB entries)
  8. 2259726Domain d2ddia1: 2ddi A:8-62 [241554]
    Other proteins in same PDB: d2ddia2, d2ddia3
    automated match to d1zr0b1

Details for d2ddia1

PDB Entry: 2ddi (more details)

PDB Description: nmr structure of the second kunitz domain of human wfikkn1
PDB Compounds: (A:) WAP, follistatin/kazal, immunoglobulin, kunitz and netrin domain containing 1

SCOPe Domain Sequences for d2ddia1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ddia1 g.8.1.0 (A:8-62) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dacvlpavqgpcrgweprwayspllqqchpfvyggcegngnnfhsrescedacpv

SCOPe Domain Coordinates for d2ddia1:

Click to download the PDB-style file with coordinates for d2ddia1.
(The format of our PDB-style files is described here.)

Timeline for d2ddia1: