Class g: Small proteins [56992] (94 folds) |
Fold g.8: BPTI-like [57361] (1 superfamily) disulfide-rich alpha+beta fold |
Superfamily g.8.1: BPTI-like [57362] (4 families) |
Family g.8.1.0: automated matches [191505] (1 protein) not a true family |
Protein automated matches [190829] (11 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [188132] (8 PDB entries) |
Domain d2ddia1: 2ddi A:8-62 [241554] Other proteins in same PDB: d2ddia2, d2ddia3 automated match to d1zr0b1 |
PDB Entry: 2ddi (more details)
SCOPe Domain Sequences for d2ddia1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ddia1 g.8.1.0 (A:8-62) automated matches {Human (Homo sapiens) [TaxId: 9606]} dacvlpavqgpcrgweprwayspllqqchpfvyggcegngnnfhsrescedacpv
Timeline for d2ddia1: