SCOPe 2.05: Domain d2d9za_: 2d9z A:

Lineage for d2d9za_ (2d9z A:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.55: PH domain-like barrel [50728] (2 superfamilies)
   barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix

4. Superfamily b.55.1: PH domain-like [50729] (14 families)

5. Family b.55.1.0: automated matches [191311] (1 protein)
   not a true family

6. Protein automated matches [190052] (5 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186914] (36 PDB entries)

8. Domain d2d9za_: 2d9z A: [241530]
   automated match to d2coaa1

Details for d2d9za_

PDB Entry: 2d9z

PDB Description: solution structure of the ph domain of protein kinase c, nu type from human

PDB Compounds: (A:) Protein kinase C, nu type

SCOPe Domain Sequences for d2d9za_:

Sequence; same for both SEQRES and ATOM records:

>d2d9za_ b.55.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gssgssgmvkegwmvhytsrdnlrkrhywrldskcltlfqnesgskyykeiplseilris
sprdftnisqgsnphcfeiitdtmvyfvgenngdsshnpvlaatgvgldvaqswekairq
almsgpssg

Timeline for d2d9za_:

• d2d9za_ first appeared in SCOPe 2.04
  
• d2d9za_ is called d2d9za1 in SCOPe 2.06
  
• d2d9za_ appears in the current release, SCOPe 2.08, called d2d9za1