PDB entry 2d9z

View 2d9z on RCSB PDB site
Description: Solution structure of the PH domain of Protein kinase C, nu type from human
Class: signaling protein
Keywords: PH domain, Protein kinase C nu type, structural genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, SIGNALING PROTEIN
Deposited on 2005-12-13, released 2007-01-02
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein kinase C, nu type
    Species: Homo sapiens [TaxId:9606]
    Gene: PRKCN, EPK2
    Database cross-references and differences (RAF-indexed):
    • Uniprot O94806 (7-122)
      • cloning artifact (0-6)
      • cloning artifact (123-128)
    Domains in SCOPe 2.05: d2d9za_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2d9zA (A:)
    gssgssgmvkegwmvhytsrdnlrkrhywrldskcltlfqnesgskyykeiplseilris
    sprdftnisqgsnphcfeiitdtmvyfvgenngdsshnpvlaatgvgldvaqswekairq
    almsgpssg