Lineage for d2d62a2 (2d62 A:244-304)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2787872Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2790988Superfamily b.40.6: MOP-like [50331] (4 families) (S)
  5. 2791140Family b.40.6.0: automated matches [254223] (1 protein)
    not a true family
  6. 2791141Protein automated matches [254506] (3 species)
    not a true protein
  7. 2791147Species Pyrococcus horikoshii [TaxId:53953] [255108] (1 PDB entry)
  8. 2791148Domain d2d62a2: 2d62 A:244-304 [241507]
    Other proteins in same PDB: d2d62a1
    automated match to d1g2913
    complexed with pop, so4

Details for d2d62a2

PDB Entry: 2d62 (more details), 2.1 Å

PDB Description: Crystal structure of multiple sugar binding transport ATP-binding protein
PDB Compounds: (A:) multiple sugar-binding transport ATP-binding protein

SCOPe Domain Sequences for d2d62a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2d62a2 b.40.6.0 (A:244-304) automated matches {Pyrococcus horikoshii [TaxId: 53953]}
gsppmnfldatitddgfldfgefklkllqdqfevleeenmvgkevifgirpedvhdasft
h

SCOPe Domain Coordinates for d2d62a2:

Click to download the PDB-style file with coordinates for d2d62a2.
(The format of our PDB-style files is described here.)

Timeline for d2d62a2: