PDB entry 2d62

View 2d62 on RCSB PDB site
Description: Crystal structure of multiple sugar binding transport ATP-binding protein
Class: sugar binding protein
Keywords: ATP-binding, Structural geomics, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, SUGAR BINDING PROTEIN
Deposited on 2005-11-08, released 2006-05-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.198
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: multiple sugar-binding transport ATP-binding protein
    Species: Pyrococcus horikoshii [TaxId:53953]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O57933 (0-374)
      • modified residue (0)
      • modified residue (3)
      • modified residue (50)
      • modified residue (87)
      • modified residue (98)
      • modified residue (128)
      • modified residue (165)
      • modified residue (180)
      • modified residue (206)
      • modified residue (208)
      • modified residue (215)
      • modified residue (247)
      • modified residue (282)
      • modified residue (359)
    Domains in SCOPe 2.07: d2d62a1, d2d62a2, d2d62a3
  • Heterogens: SO4, POP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2d62A (A:)
    migmaevkliniwkrfgdvtavkdlsleikdgeflvllgpsgcgktttlrmiagleeptr
    gqiyiednlvadpekgvfvppkerdvamvfqsyalyphmtvydniafplklrkvpkqeid
    krvrevaemlgltellnrkprelsggqrqrvalgraiirrpkvflmdeplsnldaklrvk
    mraelkklqrqlgvttiyvthdqveamtmgdriavmnkgelqqvgtpdevyykpvntfva
    gfigsppmnfldatitddgfldfgefklkllqdqfevleeenmvgkevifgirpedvhda
    sfthidvpeentvkatvdiienlggekivhlrrgnisftakfpkeskvregdevsvvfdm
    kkihifrkdtekaif