SCOPe 2.07: Domain d2byrf1: 2byr F:1-208

Lineage for d2byrf1 (2byr F:1-208)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.96: Nicotinic receptor ligand binding domain-like [63711] (1 superfamily)
   sandwich; 8 strands in 2 sheets; greek-key: partial topological similarity to immunoglobulin-like folds

4. Superfamily b.96.1: Nicotinic receptor ligand binding domain-like [63712] (2 families)

5. Family b.96.1.0: automated matches [193505] (1 protein)
   not a true family

6. Protein automated matches [193506] (5 species)
   not a true protein

7. Species California sea hare (Aplysia californica) [TaxId:6500] [230583] (67 PDB entries)

8. Domain d2byrf1: 2byr F:1-208 [241371]
   Other proteins in same PDB: d2byra2, d2byrb2, d2byrc2, d2byrd2, d2byre2, d2byrf2, d2byri2, d2byrj2
   automated match to d2c9ta_
   complexed with mlk

Details for d2byrf1

PDB Entry: 2byr, 2.45 Å

PDB Description: crystal structure of achbp from aplysia californica in complex with methyllycaconitine

PDB Compounds: (F:) acetylcholine-binding protein

SCOPe Domain Sequences for d2byrf1:

Sequence; same for both SEQRES and ATOM records:

>d2byrf1 b.96.1.0 (F:1-208) automated matches {California sea hare (Aplysia californica) [TaxId: 6500]}
hsqanlmrlksdlfnrspmypgptkddpltvtlgftlqdivkadsstnevdlvyyeqqrw
klnslmwdpneygnitdfrtsaadiwtpditaysstrpvqvlspqiavvthdgsvmfipa
qrlsfmcdptgvdseegatcavkfgswvysgfeidlktdtdqvdlssyyasskyeilsat
qtrqvqhysccpepyidvnlvvkfrerr

Timeline for d2byrf1:

• d2byrf1 first appeared in SCOPe 2.04, called d2byrf_
  
• d2byrf1 appears in SCOPe 2.06
  
• d2byrf1 appears in the current release, SCOPe 2.08