![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.96: Nicotinic receptor ligand binding domain-like [63711] (1 superfamily) sandwich; 8 strands in 2 sheets; greek-key: partial topological similarity to immunoglobulin-like folds |
![]() | Superfamily b.96.1: Nicotinic receptor ligand binding domain-like [63712] (2 families) ![]() |
![]() | Family b.96.1.0: automated matches [193505] (1 protein) not a true family |
![]() | Protein automated matches [193506] (5 species) not a true protein |
![]() | Species California sea hare (Aplysia californica) [TaxId:6500] [230583] (67 PDB entries) |
![]() | Domain d2byrf1: 2byr F:1-208 [241371] Other proteins in same PDB: d2byra2, d2byrb2, d2byrc2, d2byrd2, d2byre2, d2byrf2, d2byri2, d2byrj2 automated match to d2c9ta_ complexed with mlk |
PDB Entry: 2byr (more details), 2.45 Å
SCOPe Domain Sequences for d2byrf1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2byrf1 b.96.1.0 (F:1-208) automated matches {California sea hare (Aplysia californica) [TaxId: 6500]} hsqanlmrlksdlfnrspmypgptkddpltvtlgftlqdivkadsstnevdlvyyeqqrw klnslmwdpneygnitdfrtsaadiwtpditaysstrpvqvlspqiavvthdgsvmfipa qrlsfmcdptgvdseegatcavkfgswvysgfeidlktdtdqvdlssyyasskyeilsat qtrqvqhysccpepyidvnlvvkfrerr
Timeline for d2byrf1: