Class b: All beta proteins [48724] (178 folds) |
Fold b.96: Nicotinic receptor ligand binding domain-like [63711] (1 superfamily) sandwich; 8 strands in 2 sheets; greek-key: partial topological similarity to immunoglobulin-like folds |
Superfamily b.96.1: Nicotinic receptor ligand binding domain-like [63712] (2 families) |
Family b.96.1.0: automated matches [193505] (1 protein) not a true family |
Protein automated matches [193506] (5 species) not a true protein |
Species California sea hare (Aplysia californica) [TaxId:6500] [230583] (67 PDB entries) |
Domain d2byna1: 2byn A:1-208 [241361] Other proteins in same PDB: d2byna2, d2bynb2, d2bync2, d2bynd2, d2byne2 automated match to d2c9ta_ complexed with 1pe, nag, pg4 |
PDB Entry: 2byn (more details), 2.02 Å
SCOPe Domain Sequences for d2byna1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2byna1 b.96.1.0 (A:1-208) automated matches {California sea hare (Aplysia californica) [TaxId: 6500]} hsqanlmrlksdlfnrspmypgptkddpltvtlgftlqdivkadsstnevdlvyyeqqrw klnslmwdpneygnitdfrtsaadiwtpditaysstrpvqvlspqiavvthdgsvmfipa qrlsfmcdptgvdseegatcavkfgswvysgfeidlktdtdqvdlssyyasskyeilsat qtrqvqhysccpepyidvnlvvkfrerr
Timeline for d2byna1: