Lineage for d2byna1 (2byn A:1-208)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2428807Fold b.96: Nicotinic receptor ligand binding domain-like [63711] (1 superfamily)
    sandwich; 8 strands in 2 sheets; greek-key: partial topological similarity to immunoglobulin-like folds
  4. 2428808Superfamily b.96.1: Nicotinic receptor ligand binding domain-like [63712] (2 families) (S)
  5. 2429246Family b.96.1.0: automated matches [193505] (1 protein)
    not a true family
  6. 2429247Protein automated matches [193506] (5 species)
    not a true protein
  7. 2429248Species California sea hare (Aplysia californica) [TaxId:6500] [230583] (67 PDB entries)
  8. 2429289Domain d2byna1: 2byn A:1-208 [241361]
    Other proteins in same PDB: d2byna2, d2bynb2, d2bync2, d2bynd2, d2byne2
    automated match to d2c9ta_
    complexed with 1pe, nag, pg4

Details for d2byna1

PDB Entry: 2byn (more details), 2.02 Å

PDB Description: crystal structure of apo achbp from aplysia californica
PDB Compounds: (A:) Soluble acetylcholine receptor

SCOPe Domain Sequences for d2byna1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2byna1 b.96.1.0 (A:1-208) automated matches {California sea hare (Aplysia californica) [TaxId: 6500]}
hsqanlmrlksdlfnrspmypgptkddpltvtlgftlqdivkadsstnevdlvyyeqqrw
klnslmwdpneygnitdfrtsaadiwtpditaysstrpvqvlspqiavvthdgsvmfipa
qrlsfmcdptgvdseegatcavkfgswvysgfeidlktdtdqvdlssyyasskyeilsat
qtrqvqhysccpepyidvnlvvkfrerr

SCOPe Domain Coordinates for d2byna1:

Click to download the PDB-style file with coordinates for d2byna1.
(The format of our PDB-style files is described here.)

Timeline for d2byna1: