Lineage for d2bdio_ (2bdi O:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2404157Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2404158Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2407751Family b.47.1.0: automated matches [191364] (1 protein)
    not a true family
  6. 2407752Protein automated matches [190438] (33 species)
    not a true protein
  7. 2407799Species Human (Homo sapiens) [TaxId:9606] [187421] (92 PDB entries)
  8. 2407944Domain d2bdio_: 2bdi O: [241306]
    automated match to d2bdga_
    complexed with co, pbz

Details for d2bdio_

PDB Entry: 2bdi (more details), 3 Å

PDB Description: Human Kallikrein 4 complex with cobalt and p-aminobenzamidine
PDB Compounds: (O:) Kallikrein-4

SCOPe Domain Sequences for d2bdio_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bdio_ b.47.1.0 (O:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iingedcsphsqpwqaalvmenelfcsgvlvhpqwvlsaahcfqnsytiglglhsleadq
epgsqmveaslsvrhpeynrpllandlmlikldesvsesdtirsisiasqcptagnsclv
sgwgllangrmptvlqcvnvsvvseevcsklydplyhpsmfcagggqdqkdscngdsggp
licngylqglvsfgkapcgqvgvpgvytnlckftewiektvqa

SCOPe Domain Coordinates for d2bdio_:

Click to download the PDB-style file with coordinates for d2bdio_.
(The format of our PDB-style files is described here.)

Timeline for d2bdio_: