Lineage for d2b2gb_ (2b2g B:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2203937Fold d.85: RNA bacteriophage capsid protein [55404] (1 superfamily)
    6-standed beta-sheet followed with 2 helices; meander
  4. 2203938Superfamily d.85.1: RNA bacteriophage capsid protein [55405] (1 family) (S)
  5. 2203939Family d.85.1.1: RNA bacteriophage capsid protein [55406] (6 proteins)
  6. 2203988Protein MS2 virus coat protein [55407] (1 species)
  7. 2203989Species Bacteriophage MS2 [TaxId:12022] [55408] (36 PDB entries)
    Uniprot P03612
  8. 2204084Domain d2b2gb_: 2b2g B: [241254]
    automated match to d2bu1a_
    protein/RNA complex; mutant

Details for d2b2gb_

PDB Entry: 2b2g (more details), 3.02 Å

PDB Description: ms2 wild-type rna stemloop complexed with an n87s mutant ms2 capsid
PDB Compounds: (B:) coat protein

SCOPe Domain Sequences for d2b2gb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2b2gb_ d.85.1.1 (B:) MS2 virus coat protein {Bacteriophage MS2 [TaxId: 12022]}
asnftqfvlvdnggtgdvtvapsnfangvaewissnsrsqaykvtcsvrqssaqnrkyti
kvevpkvatqtvggvelpvaawrsylsmeltipifatnsdcelivkamqgllkdgnpips
aiaansgiy

SCOPe Domain Coordinates for d2b2gb_:

Click to download the PDB-style file with coordinates for d2b2gb_.
(The format of our PDB-style files is described here.)

Timeline for d2b2gb_: