Lineage for d1zwoa1 (1zwo A:1-90)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2368998Fold b.11: gamma-Crystallin-like [49694] (1 superfamily)
    sandwich; 8 strands in 2 sheets; greek-key
    duplication: has internal pseudo twofold symmetry
  4. 2368999Superfamily b.11.1: gamma-Crystallin-like [49695] (7 families) (S)
  5. 2369000Family b.11.1.1: Crystallins/Ca-binding development proteins [49696] (5 protein domains)
  6. 2369038Protein gamma-Crystallin [49697] (9 species)
    duplication consists of two domains of this fold
  7. 2369076Species Mouse (Mus musculus) [TaxId:10090] [255018] (3 PDB entries)
  8. 2369079Domain d1zwoa1: 1zwo A:1-90 [241173]
    automated match to d1amma1

Details for d1zwoa1

PDB Entry: 1zwo (more details)

PDB Description: NMR structure of murine gamma-S crystallin
PDB Compounds: (A:) gamma crystallin s

SCOPe Domain Sequences for d1zwoa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zwoa1 b.11.1.1 (A:1-90) gamma-Crystallin {Mouse (Mus musculus) [TaxId: 10090]}
sktggkisfyedrnfqgrrydcdcdcadfrsylsrcnsirveggtwavyerpnfsghmyi
lpqgeypeyqrwmglndrlgscravhlssg

SCOPe Domain Coordinates for d1zwoa1:

Click to download the PDB-style file with coordinates for d1zwoa1.
(The format of our PDB-style files is described here.)

Timeline for d1zwoa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1zwoa2