Lineage for d1ztgc1 (1ztg C:14-83)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2947085Fold d.51: Eukaryotic type KH-domain (KH-domain type I) [54790] (1 superfamily)
    beta-alpha(2)-beta(2)-alpha; 2 layers: alpha/beta
  4. 2947086Superfamily d.51.1: Eukaryotic type KH-domain (KH-domain type I) [54791] (2 families) (S)
    Prokaryotic and eukaryotic domains share a KH-motif but have different topologies
  5. 2947087Family d.51.1.1: Eukaryotic type KH-domain (KH-domain type I) [54792] (17 proteins)
    an RNA-binding domain
  6. 2947178Protein automated matches [195910] (2 species)
    not a true protein
  7. 2947179Species Human (Homo sapiens) [TaxId:9606] [195911] (4 PDB entries)
  8. 2947189Domain d1ztgc1: 1ztg C:14-83 [241162]
    Other proteins in same PDB: d1ztga2, d1ztgb2, d1ztgc2, d1ztgd2
    automated match to d3vkea_
    protein/DNA complex; protein/RNA complex

Details for d1ztgc1

PDB Entry: 1ztg (more details), 3 Å

PDB Description: human alpha polyC binding protein KH1
PDB Compounds: (C:) Poly(rC)-binding protein 1

SCOPe Domain Sequences for d1ztgc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ztgc1 d.51.1.1 (C:14-83) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ltirllmhgkevgsiigkkgesvkrireesgarinisegncperiitltgptnaifkafa
miidkleedi

SCOPe Domain Coordinates for d1ztgc1:

Click to download the PDB-style file with coordinates for d1ztgc1.
(The format of our PDB-style files is described here.)

Timeline for d1ztgc1: