Lineage for d1zmxa_ (1zmx A:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1593542Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 1593543Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 1593544Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (21 proteins)
    parallel beta-sheet of 5 strands, order 23145
  6. 1594046Protein automated matches [190087] (8 species)
    not a true protein
  7. 1594053Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [233748] (5 PDB entries)
  8. 1594069Domain d1zmxa_: 1zmx A: [241149]
    automated match to d2vp4d_
    complexed with so4, thm; mutant

Details for d1zmxa_

PDB Entry: 1zmx (more details), 3.1 Å

PDB Description: crystal structure of d. melanogaster deoxyribonucleoside kinase n64d mutant in complex with thymidine
PDB Compounds: (A:) deoxynucleoside kinase

SCOPe Domain Sequences for d1zmxa_:

Sequence, based on SEQRES records: (download)

>d1zmxa_ c.37.1.1 (A:) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
tkyaegtqpftvliegnigsgkttylnhfekykndiclltepvekwrnvngvdllelmyk
dpkkwampfqsyvtltmlqshtaptnkklkimersifsarycfvenmrrngsleqgmynt
leewykfieesihvqadliiylrtspevayerirqrarseescvplkylqelhelhedwl
ihqrrpqsckvlvldad

Sequence, based on observed residues (ATOM records): (download)

>d1zmxa_ c.37.1.1 (A:) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
tkyaegtqpftvliegnigsgkttylnhfekykndiclltepvekwrnvngvdllelmyk
dpkkwampfqsyvtltmlqshtaptnkklkimersifsarycfvenmrrngsleqgmynt
leewykfieesihvqadliiylrtspevayerirqrvplkylqelhelhedwlihqrrpq
sckvlvldad

SCOPe Domain Coordinates for d1zmxa_:

Click to download the PDB-style file with coordinates for d1zmxa_.
(The format of our PDB-style files is described here.)

Timeline for d1zmxa_: