Class b: All beta proteins [48724] (176 folds) |
Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) |
Family b.47.1.0: automated matches [191364] (1 protein) not a true family |
Protein automated matches [190438] (20 species) not a true protein |
Species Human coxsackievirus b4 [TaxId:12073] [255005] (1 PDB entry) |
Domain d1z8ra_: 1z8r A: [241123] automated match to d4mg3b_ complexed with zn |
PDB Entry: 1z8r (more details)
SCOPe Domain Sequences for d1z8ra_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1z8ra_ b.47.1.0 (A:) automated matches {Human coxsackievirus b4 [TaxId: 12073]} gpyghqsgavyvgnykvvnrhlathvdwqncvwedynrdllvstttahgcdtiarcqctt gvyfcaskskhypvsfegpglvevqeseyypkryqshvllatgfsepgdaggilrcehgv iglvtmggegvvgfadvrdllwleddameq
Timeline for d1z8ra_: