Lineage for d1z8ra_ (1z8r A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1793083Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 1793084Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 1795550Family b.47.1.0: automated matches [191364] (1 protein)
    not a true family
  6. 1795551Protein automated matches [190438] (20 species)
    not a true protein
  7. 1795658Species Human coxsackievirus b4 [TaxId:12073] [255005] (1 PDB entry)
  8. 1795659Domain d1z8ra_: 1z8r A: [241123]
    automated match to d4mg3b_
    complexed with zn

Details for d1z8ra_

PDB Entry: 1z8r (more details)

PDB Description: 2a cysteine proteinase from human coxsackievirus b4 (strain jvb / benschoten / new york / 51)
PDB Compounds: (A:) Coxsackievirus B4 polyprotein

SCOPe Domain Sequences for d1z8ra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1z8ra_ b.47.1.0 (A:) automated matches {Human coxsackievirus b4 [TaxId: 12073]}
gpyghqsgavyvgnykvvnrhlathvdwqncvwedynrdllvstttahgcdtiarcqctt
gvyfcaskskhypvsfegpglvevqeseyypkryqshvllatgfsepgdaggilrcehgv
iglvtmggegvvgfadvrdllwleddameq

SCOPe Domain Coordinates for d1z8ra_:

Click to download the PDB-style file with coordinates for d1z8ra_.
(The format of our PDB-style files is described here.)

Timeline for d1z8ra_: