SCOPe 2.07: Domain d1z5hb3: 1z5h B:415-489

Lineage for d1z5hb3 (1z5h B:415-489)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.30: Zn aminopeptidase insert domain [254133] (2 families)
   same topology as (b.1.15.1)

5. Family b.1.30.1: Zn aminopeptidase insert domain [254169] (3 proteins)

6. Protein Tricorn protease interacting factor F3 insert domain [254383] (1 species)

7. Species Thermoplasma acidophilum [TaxId:2303] [254816] (2 PDB entries)

8. Domain d1z5hb3: 1z5h B:415-489 [241116]
   Other proteins in same PDB: d1z5ha1, d1z5ha2, d1z5ha4, d1z5hb1, d1z5hb2, d1z5hb4
   automated match to d1z1wa3
   complexed with so4, zn

Details for d1z5hb3

PDB Entry: 1z5h, 2.3 Å

PDB Description: crystal structures of the tricorn interacting factor f3 from thermoplasma acidophilum

PDB Compounds: (B:) Tricorn protease interacting factor F3

SCOPe Domain Sequences for d1z5hb3:

Sequence; same for both SEQRES and ATOM records:

>d1z5hb3 b.1.30.1 (B:415-489) Tricorn protease interacting factor F3 insert domain {Thermoplasma acidophilum [TaxId: 2303]}
gypviklkrngrkitmyqtrfllngeeegrwpvpvnikkkdgverilledeasieadgli
kinadsagfyrvlyd

Timeline for d1z5hb3:

• d1z5hb3 first appeared in SCOPe 2.04
  
• d1z5hb3 appears in SCOPe 2.06
  
• d1z5hb3 appears in the current release, SCOPe 2.08