Lineage for d1z5ha1 (1z5h A:1-170)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1562417Fold b.98: Zn aminopeptidase N-terminal domain [63736] (1 superfamily)
    duplication: two beta-sandwiches of similar topologies are fused together in a single three beta-sheet domain
  4. 1562418Superfamily b.98.1: Zn aminopeptidase N-terminal domain [63737] (2 families) (S)
  5. 1562419Family b.98.1.1: Zn aminopeptidase N-terminal domain [63738] (4 proteins)
  6. 1562479Protein Tricorn protease interacting factor F3 N-terminal domain [254379] (1 species)
  7. 1562480Species Thermoplasma acidophilum [TaxId:2303] [254812] (2 PDB entries)
  8. 1562481Domain d1z5ha1: 1z5h A:1-170 [241110]
    Other proteins in same PDB: d1z5ha2, d1z5ha3, d1z5ha4, d1z5hb2, d1z5hb3, d1z5hb4
    automated match to d1z1wa1
    complexed with so4, zn

Details for d1z5ha1

PDB Entry: 1z5h (more details), 2.3 Å

PDB Description: crystal structures of the tricorn interacting factor f3 from thermoplasma acidophilum
PDB Compounds: (A:) Tricorn protease interacting factor F3

SCOPe Domain Sequences for d1z5ha1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1z5ha1 b.98.1.1 (A:1-170) Tricorn protease interacting factor F3 N-terminal domain {Thermoplasma acidophilum [TaxId: 2303]}
mevekydltldfdiqkrtfngtetitadagdivldavglqinwmkvngrdtaftydgqtv
rapgdsqpqkieisfagkvsdslsgiyyagrengmitthfeatdarrmfpcvdhpaykav
faitvvidkdydaisnmppkrievserkvvefqdtprmstyllyvgigkf

SCOPe Domain Coordinates for d1z5ha1:

Click to download the PDB-style file with coordinates for d1z5ha1.
(The format of our PDB-style files is described here.)

Timeline for d1z5ha1: