SCOPe 2.05: Domain d1yyha_: 1yyh A:

Lineage for d1yyha_ (1yyh A:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.211: beta-hairpin-alpha-hairpin repeat [74651] (2 superfamilies)
   multiple repeats of beta(2)-alpha(2) motif

4. Superfamily d.211.1: Ankyrin repeat [48403] (2 families)
   repeats organized in elongated structures

5. Family d.211.1.1: Ankyrin repeat [48404] (19 proteins)
   this is a repeat family; one repeat unit is 1ixv A:101-134 found in domain

6. Protein automated matches [190101] (6 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187689] (6 PDB entries)

8. Domain d1yyha_: 1yyh A: [241086]
   automated match to d2f8ya_

Details for d1yyha_

PDB Entry: 1yyh, 1.9 Å

PDB Description: crystal structure of the human notch 1 ankyrin domain

PDB Compounds: (A:) Notch 1, ankyrin domain

SCOPe Domain Sequences for d1yyha_:

Sequence; same for both SEQRES and ATOM records:

>d1yyha_ d.211.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qtdrtgetalhlaarysrsdaakrlleasadaniqdnmgrtplhaavsadaqgvfqilir
nratdldarmhdgttplilaarlavegmledlinshadvnavddlgksalhwaaavnnvd
aavvllkngankdmqnnreetplflaaregsyetakvlldhfanrditdhmdrlprdiaq
ermhhdivrlldl

Timeline for d1yyha_:

• d1yyha_ first appeared in SCOPe 2.04
  
• d1yyha_ is called d1yyha1 in SCOPe 2.06
  
• d1yyha_ appears in the current release, SCOPe 2.08, called d1yyha1