Lineage for d1yyha1 (1yyh A:52-243)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2563231Fold d.211: beta-hairpin-alpha-hairpin repeat [74651] (2 superfamilies)
    multiple repeats of beta(2)-alpha(2) motif
  4. 2563232Superfamily d.211.1: Ankyrin repeat [48403] (2 families) (S)
    repeats organized in elongated structures
  5. 2563233Family d.211.1.1: Ankyrin repeat [48404] (19 proteins)
  6. 2563325Protein automated matches [190101] (7 species)
    not a true protein
  7. 2563347Species Human (Homo sapiens) [TaxId:9606] [187689] (9 PDB entries)
  8. 2563350Domain d1yyha1: 1yyh A:52-243 [241086]
    Other proteins in same PDB: d1yyha2
    automated match to d2f8ya_

Details for d1yyha1

PDB Entry: 1yyh (more details), 1.9 Å

PDB Description: crystal structure of the human notch 1 ankyrin domain
PDB Compounds: (A:) Notch 1, ankyrin domain

SCOPe Domain Sequences for d1yyha1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yyha1 d.211.1.1 (A:52-243) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qtdrtgetalhlaarysrsdaakrlleasadaniqdnmgrtplhaavsadaqgvfqilir
nratdldarmhdgttplilaarlavegmledlinshadvnavddlgksalhwaaavnnvd
aavvllkngankdmqnnreetplflaaregsyetakvlldhfanrditdhmdrlprdiaq
ermhhdivrlld

SCOPe Domain Coordinates for d1yyha1:

Click to download the PDB-style file with coordinates for d1yyha1.
(The format of our PDB-style files is described here.)

Timeline for d1yyha1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1yyha2
View in 3D
Domains from other chains:
(mouse over for more information)
d1yyhb_