Lineage for d1yx3a_ (1yx3 A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2612053Fold d.203: DsrC, the gamma subunit of dissimilatory sulfite reductase [69720] (1 superfamily)
    beta(3)-alpha(5); meander beta-sheet packed against array of helices
  4. 2612054Superfamily d.203.1: DsrC, the gamma subunit of dissimilatory sulfite reductase [69721] (2 families) (S)
  5. 2612055Family d.203.1.1: DsrC, the gamma subunit of dissimilatory sulfite reductase [69722] (2 proteins)
    automatically mapped to Pfam PF04358
  6. 2612056Protein DsrC, the gamma subunit of dissimilatory sulfite reductase [69723] (4 species)
  7. 2612057Species Allochromatium vinosum [TaxId:1049] [256392] (1 PDB entry)
  8. 2612058Domain d1yx3a_: 1yx3 A: [241079]
    automated match to d3or2c_

Details for d1yx3a_

PDB Entry: 1yx3 (more details)

PDB Description: nmr structure of allochromatium vinosum dsrc: northeast structural genomics consortium target op4
PDB Compounds: (A:) hypothetical protein DsrC

SCOPe Domain Sequences for d1yx3a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yx3a_ d.203.1.1 (A:) DsrC, the gamma subunit of dissimilatory sulfite reductase {Allochromatium vinosum [TaxId: 1049]}
madtievdgkqfavdeegylsnlndwvpgvadvmakqdnlelteehwdiinflreyyeey
qiapavrvltkavgkklgkekgnskylyslfpygpakqacrfaglpkptgcv

SCOPe Domain Coordinates for d1yx3a_:

Click to download the PDB-style file with coordinates for d1yx3a_.
(The format of our PDB-style files is described here.)

Timeline for d1yx3a_: