Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.203: DsrC, the gamma subunit of dissimilatory sulfite reductase [69720] (1 superfamily) beta(3)-alpha(5); meander beta-sheet packed against array of helices |
Superfamily d.203.1: DsrC, the gamma subunit of dissimilatory sulfite reductase [69721] (2 families) |
Family d.203.1.1: DsrC, the gamma subunit of dissimilatory sulfite reductase [69722] (2 proteins) automatically mapped to Pfam PF04358 |
Protein DsrC, the gamma subunit of dissimilatory sulfite reductase [69723] (4 species) |
Species Allochromatium vinosum [TaxId:1049] [256392] (1 PDB entry) |
Domain d1yx3a_: 1yx3 A: [241079] automated match to d3or2c_ |
PDB Entry: 1yx3 (more details)
SCOPe Domain Sequences for d1yx3a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1yx3a_ d.203.1.1 (A:) DsrC, the gamma subunit of dissimilatory sulfite reductase {Allochromatium vinosum [TaxId: 1049]} madtievdgkqfavdeegylsnlndwvpgvadvmakqdnlelteehwdiinflreyyeey qiapavrvltkavgkklgkekgnskylyslfpygpakqacrfaglpkptgcv
Timeline for d1yx3a_: