Lineage for d1ya5a2 (1ya5 A:101-196)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2754280Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)
  8. 2756696Domain d1ya5a2: 1ya5 A:101-196 [240998]
    Other proteins in same PDB: d1ya5a3, d1ya5b3
    automated match to d1g1ca_
    complexed with so4

Details for d1ya5a2

PDB Entry: 1ya5 (more details), 2.44 Å

PDB Description: crystal structure of the titin domains z1z2 in complex with telethonin
PDB Compounds: (A:) N2B-Titin Isoform

SCOPe Domain Sequences for d1ya5a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ya5a2 b.1.1.0 (A:101-196) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tappnfvqrlqsmtvrqgsqvrlqvrvtgiptpvvkfyrdgaeiqssldfqisqegdlys
lliaeaypedsgtysvnatnsvgratstaellvqge

SCOPe Domain Coordinates for d1ya5a2:

Click to download the PDB-style file with coordinates for d1ya5a2.
(The format of our PDB-style files is described here.)

Timeline for d1ya5a2: