Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.4: I set domains [49159] (39 proteins) |
Protein Titin [49172] (1 species) |
Species Human (Homo sapiens), different modules [TaxId:9606] [49173] (8 PDB entries) |
Domain d1g1ca_: 1g1c A: [65078] module I1 |
PDB Entry: 1g1c (more details), 2.1 Å
SCOPe Domain Sequences for d1g1ca_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1g1ca_ b.1.1.4 (A:) Titin {Human (Homo sapiens), different modules [TaxId: 9606]} smeapkiferiqsqtvgqgsdahfrvrvvgkpdpecewykngvkiersdriywywpednv celvirdvtgedsasimvkainiagetsshafllvqak
Timeline for d1g1ca_: