Lineage for d1wx5c1 (1wx5 C:2-273)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2719416Fold a.86: Di-copper centre-containing domain [48055] (1 superfamily)
    multihelical
  4. 2719417Superfamily a.86.1: Di-copper centre-containing domain [48056] (4 families) (S)
    duplication: contains two structural repeats
  5. 2719457Family a.86.1.3: Tyrosinase [254185] (1 protein)
    Pfam PF00264
  6. 2719458Protein Tyrosinase [254409] (1 species)
  7. 2719459Species Streptomyces castaneoglobisporus [TaxId:79261] [254848] (23 PDB entries)
  8. 2719483Domain d1wx5c1: 1wx5 C:2-273 [240923]
    Other proteins in same PDB: d1wx5a2, d1wx5b_, d1wx5c2, d1wx5d_
    automated match to d2ahka_
    complexed with cl, na

Details for d1wx5c1

PDB Entry: 1wx5 (more details), 2.02 Å

PDB Description: Crystal Structure of the copper-free Streptomyces castaneoglobisporus tyrosinase complexed with a caddie protein in the monoclinic crystal
PDB Compounds: (C:) tyrosinase

SCOPe Domain Sequences for d1wx5c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wx5c1 a.86.1.3 (C:2-273) Tyrosinase {Streptomyces castaneoglobisporus [TaxId: 79261]}
tvrknqatltadekrrfvaavlelkrsgrydefvrthnefimsdtdsgertghrspsflp
whrrflldfeqalqsvdssvtlpywdwsadrtvraslwapdflggtgrstdgrvmdgpfa
astgnwpinvrvdsrtylrrslggsvaelptraevesvlaisaydlppynsasegfrnhl
egwrgvnlhnrvhvwvggqmatgvspndpvfwlhhayvdklwaewqrrhpdsayvptggt
pdvvdlnetmkpwntvrpadlldhtayytfda

SCOPe Domain Coordinates for d1wx5c1:

Click to download the PDB-style file with coordinates for d1wx5c1.
(The format of our PDB-style files is described here.)

Timeline for d1wx5c1: