Lineage for d1vu3h_ (1vu3 H:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1786638Fold b.38: Sm-like fold [50181] (5 superfamilies)
    core: barrel, open; n*=4, S*=8; meander; SH3-like topology
  4. 1786639Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (7 families) (S)
  5. 1787219Family b.38.1.0: automated matches [191538] (1 protein)
    not a true family
  6. 1787220Protein automated matches [190914] (10 species)
    not a true protein
  7. 1787282Species Human (Homo sapiens) [TaxId:9606] [196227] (4 PDB entries)
  8. 1787307Domain d1vu3h_: 1vu3 H: [240875]
    Other proteins in same PDB: d1vu3a_, d1vu3b_, d1vu3g_, d1vu3i_, d1vu3j_, d1vu3o_, d1vu3q_, d1vu3r_, d1vu3y_, d1vu3z_
    complexed with so4
    complexed with so4

Details for d1vu3h_

PDB Entry: 1vu3 (more details), 3.1 Å

PDB Description: The 8S snRNP Assembly Intermediate
PDB Compounds: (H:) Small nuclear ribonucleoprotein G

SCOPe Domain Sequences for d1vu3h_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vu3h_ b.38.1.0 (H:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
hppelkkfmdkklslklnggrhvqgilrgfdpfmnlvidecvematsgqqnnigmvvirg
nsiimleale

SCOPe Domain Coordinates for d1vu3h_:

Click to download the PDB-style file with coordinates for d1vu3h_.
(The format of our PDB-style files is described here.)

Timeline for d1vu3h_: