Lineage for d1vu3i_ (1vu3 I:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1786638Fold b.38: Sm-like fold [50181] (5 superfamilies)
    core: barrel, open; n*=4, S*=8; meander; SH3-like topology
  4. 1786639Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (7 families) (S)
  5. 1786640Family b.38.1.1: Sm motif of small nuclear ribonucleoproteins, SNRNP [50183] (8 proteins)
    forms homo and heteroheptameric ring structures
  6. 1786818Protein D1 core SNRNP protein [50184] (2 species)
  7. 1786819Species Human (Homo sapiens) [TaxId:9606] [50185] (5 PDB entries)
  8. 1786838Domain d1vu3i_: 1vu3 I: [240876]
    Other proteins in same PDB: d1vu3b_, d1vu3d_, d1vu3f_, d1vu3h_, d1vu3j_, d1vu3l_, d1vu3n_, d1vu3p_, d1vu3r_, d1vu3t_, d1vu3v_, d1vu3x_, d1vu3z_
    complexed with so4
    complexed with so4

Details for d1vu3i_

PDB Entry: 1vu3 (more details), 3.1 Å

PDB Description: The 8S snRNP Assembly Intermediate
PDB Compounds: (I:) Small nuclear ribonucleoprotein Sm D1

SCOPe Domain Sequences for d1vu3i_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vu3i_ b.38.1.1 (I:) D1 core SNRNP protein {Human (Homo sapiens) [TaxId: 9606]}
klvrflmklshetvtielkngtqvhgtitgvdvsmnthlkavkmtlknrepvqletlsir
gnniryfilpdslpldtllvdv

SCOPe Domain Coordinates for d1vu3i_:

Click to download the PDB-style file with coordinates for d1vu3i_.
(The format of our PDB-style files is described here.)

Timeline for d1vu3i_: