Lineage for d1vu3d_ (1vu3 D:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2396390Fold b.38: Sm-like fold [50181] (5 superfamilies)
    core: barrel, open; n*=4, S*=8; meander; SH3-like topology
  4. 2396391Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (7 families) (S)
  5. 2397050Family b.38.1.0: automated matches [191538] (1 protein)
    not a true family
  6. 2397051Protein automated matches [190914] (14 species)
    not a true protein
  7. 2397156Species Human (Homo sapiens) [TaxId:9606] [196227] (11 PDB entries)
  8. 2397205Domain d1vu3d_: 1vu3 D: [240872]
    Other proteins in same PDB: d1vu3a_, d1vu3b_, d1vu3g_, d1vu3i_, d1vu3j_, d1vu3o_, d1vu3q_, d1vu3r_, d1vu3y_, d1vu3z_
    complexed with so4
    complexed with so4

Details for d1vu3d_

PDB Entry: 1vu3 (more details), 3.1 Å

PDB Description: The 8S snRNP Assembly Intermediate
PDB Compounds: (D:) Small nuclear ribonucleoprotein F

SCOPe Domain Sequences for d1vu3d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vu3d_ b.38.1.0 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
npkpflngltgkpvmvklkwgmeykgylvsvdgymnmqlanteeyidgalsghlgevlir
cnnvlyirgve

SCOPe Domain Coordinates for d1vu3d_:

Click to download the PDB-style file with coordinates for d1vu3d_.
(The format of our PDB-style files is described here.)

Timeline for d1vu3d_: