SCOPe 2.02: Domain d2pelb_: 2pel B:

Lineage for d2pelb_ (2pel B:)

1. Root: SCOPe 2.02

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families)

5. Family b.29.1.1: Legume lectins [49900] (5 proteins)

6. Protein Legume lectin [49904] (23 species)

7. Species Peanut (Arachis hypogaea) [TaxId:3818] [49912] (23 PDB entries)
   Uniprot P02872 24-255

8. Domain d2pelb_: 2pel B: [24083]
   complexed with ca, lat, lbt, mn

Details for d2pelb_

PDB Entry: 2pel, 2.25 Å

PDB Description: peanut lectin

PDB Compounds: (B:) peanut lectin

SCOPe Domain Sequences for d2pelb_:

Sequence; same for both SEQRES and ATOM records:

>d2pelb_ b.29.1.1 (B:) Legume lectin {Peanut (Arachis hypogaea) [TaxId: 3818]}
aetvsfnfnsfsegnpainfqgdvtvlsngniqltnlnkvnsvgrvlyampvriwssatg
nvasfltsfsfemkdikdydpadgiiffiapedtqipagsigggtlgvsdtkgaghfvgv
efdtysnseyndpptdhvgidvnsvdsvktvpwnsvsgavvkvtviydsstktlsvavtn
dngdittiaqvvdlkaklpervkfgfsasgslggrqihlirswsftstlitt

Timeline for d2pelb_:

• d2pelb_ first appeared (with stable ids) in SCOP 1.55
  
• d2pelb_ appears in SCOPe 2.01
  
• d2pelb_ appears in SCOPe 2.03
  
• d2pelb_ appears in the current release, SCOPe 2.08