![]() | Class g: Small proteins [56992] (100 folds) |
![]() | Fold g.7: Snake toxin-like [57301] (1 superfamily) disulfide-rich fold: nearly all-beta |
![]() | Superfamily g.7.1: Snake toxin-like [57302] (4 families) ![]() |
![]() | Family g.7.1.1: Snake venom toxins [57303] (28 proteins) automatically mapped to Pfam PF00087 |
![]() | Protein automated matches [190676] (9 species) not a true protein |
![]() | Species Naja oxiana [TaxId:8657] [254885] (6 PDB entries) |
![]() | Domain d1rl5a_: 1rl5 A: [240751] automated match to d2cdxa_ |
PDB Entry: 1rl5 (more details)
SCOPe Domain Sequences for d1rl5a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rl5a_ g.7.1.1 (A:) automated matches {Naja oxiana [TaxId: 8657]} lkcnklvpiayktcpegknlcykmfmmsdltipvkrgcidvcpknsllvkyvccntdrcn
Timeline for d1rl5a_: