Lineage for d1rl5a_ (1rl5 A:)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3032122Fold g.7: Snake toxin-like [57301] (1 superfamily)
    disulfide-rich fold: nearly all-beta
  4. 3032123Superfamily g.7.1: Snake toxin-like [57302] (4 families) (S)
  5. 3032124Family g.7.1.1: Snake venom toxins [57303] (28 proteins)
    automatically mapped to Pfam PF00087
  6. 3032326Protein automated matches [190676] (9 species)
    not a true protein
  7. 3032350Species Naja oxiana [TaxId:8657] [254885] (6 PDB entries)
  8. 3032355Domain d1rl5a_: 1rl5 A: [240751]
    automated match to d2cdxa_

Details for d1rl5a_

PDB Entry: 1rl5 (more details)

PDB Description: nmr structure with tightly bound water molecule of cytotoxin i from naja oxiana in aqueous solution (major form)
PDB Compounds: (A:) Cytotoxin 1

SCOPe Domain Sequences for d1rl5a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rl5a_ g.7.1.1 (A:) automated matches {Naja oxiana [TaxId: 8657]}
lkcnklvpiayktcpegknlcykmfmmsdltipvkrgcidvcpknsllvkyvccntdrcn

SCOPe Domain Coordinates for d1rl5a_:

Click to download the PDB-style file with coordinates for d1rl5a_.
(The format of our PDB-style files is described here.)

Timeline for d1rl5a_: