Lineage for d4oj7b_ (4oj7 B:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1749889Fold a.130: Chorismate mutase II [48599] (1 superfamily)
    multihelical; core: 6 helices, bundle
  4. 1749890Superfamily a.130.1: Chorismate mutase II [48600] (5 families) (S)
  5. 1749950Family a.130.1.0: automated matches [237401] (1 protein)
    not a true family
  6. 1749951Protein automated matches [237402] (1 species)
    not a true protein
  7. 1749952Species Burkholderia thailandensis [TaxId:271848] [237403] (1 PDB entry)
  8. 1749954Domain d4oj7b_: 4oj7 B: [240709]
    automated match to d4oj7c_
    complexed with edo, no3

Details for d4oj7b_

PDB Entry: 4oj7 (more details), 2.15 Å

PDB Description: crystal structure of chorismate mutase from burkholderia thailandensis
PDB Compounds: (B:) chorismate mutase

SCOPe Domain Sequences for d4oj7b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4oj7b_ a.130.1.0 (B:) automated matches {Burkholderia thailandensis [TaxId: 271848]}
dgddtaltnlvalasqrlalaepvahwkwinrkpisdppreaalltdvekratangvdpa
yartffddqiaaskqlqnalfatwrathgpegpapdlatstrpqldrltqsliaalarva
plrdapdcpsrlarsianwktltrydsaqkdalgtalshvca

SCOPe Domain Coordinates for d4oj7b_:

Click to download the PDB-style file with coordinates for d4oj7b_.
(The format of our PDB-style files is described here.)

Timeline for d4oj7b_: