Lineage for d4nrlf_ (4nrl F:)

  1. Root: SCOPe 2.04
  2. 1708126Class h: Coiled coil proteins [57942] (7 folds)
  3. 1709414Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 1709415Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 1709416Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)
  6. 1709417Protein Influenza hemagglutinin (stalk) [58066] (7 species)
    trimer
  7. 1709726Species Influenza b virus [TaxId:107412] [256374] (3 PDB entries)
  8. 1709735Domain d4nrlf_: 4nrl F: [240657]
    Other proteins in same PDB: d4nrla_, d4nrlc_, d4nrle_
    automated match to d1ti8b1
    complexed with nag; mutant

Details for d4nrlf_

PDB Entry: 4nrl (more details), 2.72 Å

PDB Description: structure of hemagglutinin with f95y mutation of influenza virus b/lee/40
PDB Compounds: (F:) Hemagglutinin HA2 chain

SCOPe Domain Sequences for d4nrlf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4nrlf_ h.3.1.1 (F:) Influenza hemagglutinin (stalk) {Influenza b virus [TaxId: 107412]}
gffgaiagfleggwegmiagwhgytshgahgvavaadlkstqeainkitknlnslselev
knlqrlsgamnelhdeileldekvddlradtissqielavllsnegiinsedehllaler
klkkmlgpsaveigngcfetkhkcnqtcldriaagtfnagdfslptfds

SCOPe Domain Coordinates for d4nrlf_:

Click to download the PDB-style file with coordinates for d4nrlf_.
(The format of our PDB-style files is described here.)

Timeline for d4nrlf_: