Lineage for d4neek_ (4nee K:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1920615Fold d.102: Regulatory factor Nef [55670] (1 superfamily)
    alpha(2)-beta(4)-alpha; 3 layers: alpha/beta/alpha
  4. 1920616Superfamily d.102.1: Regulatory factor Nef [55671] (2 families) (S)
  5. 1920638Family d.102.1.0: automated matches [191617] (1 protein)
    not a true family
  6. 1920639Protein automated matches [191127] (2 species)
    not a true protein
  7. 1920640Species Human immunodeficiency virus 1 [TaxId:11676] [236469] (1 PDB entry)
  8. 1920644Domain d4neek_: 4nee K: [240623]
    Other proteins in same PDB: d4need_, d4neef_, d4neei_, d4neel_
    automated match to d4neee_

Details for d4neek_

PDB Entry: 4nee (more details), 2.88 Å

PDB Description: crystal structure of AP-2 alpha/simga2 complex bound to HIV-1 Nef
PDB Compounds: (K:) Protein Nef

SCOPe Domain Sequences for d4neek_:

Sequence, based on SEQRES records: (download)

>d4neek_ d.102.1.0 (K:) automated matches {Human immunodeficiency virus 1 [TaxId: 11676]}
xxxxxxxxxxxxxeeevgfpvtpqvplrpmtykaavdlshflkekggleglihsqrrqdi
ldlwiyhtqgyfpdwqnytpgpgvrypltfgwcyklvpvepdkveeankgentsllhpvs
lhgmddperevlewrfdsrlafhhvarelhpeyf

Sequence, based on observed residues (ATOM records): (download)

>d4neek_ d.102.1.0 (K:) automated matches {Human immunodeficiency virus 1 [TaxId: 11676]}
xxxxxxxxxxxxxqvplrpmtykaavdlshflkekggleglihsqrrqdildlwiyhtqg
yfpdwqnytpgpgvrypltfgwcyklvpvepdkveeankgentsllhpvslhgmddpere
vlewrfdsrlafhhvarelhpeyf

SCOPe Domain Coordinates for d4neek_:

Click to download the PDB-style file with coordinates for d4neek_.
(The format of our PDB-style files is described here.)

Timeline for d4neek_: