SCOPe 2.05: Domain d4neei_: 4nee I:

Lineage for d4neei_ (4nee I:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.110: Profilin-like [55769] (10 superfamilies)
   core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha

4. Superfamily d.110.4: SNARE-like [64356] (5 families)
   beta(2)-alpha-beta(3)-alpha(2)

5. Family d.110.4.2: Clathrin coat assembly domain [75521] (2 proteins)
   automatically mapped to Pfam PF01217

6. Protein Sigma2 adaptin (clathrin coat assembly protein AP17) [75524] (1 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [75525] (4 PDB entries)

8. Domain d4neei_: 4nee I: [236473]
   Other proteins in same PDB: d4neec1, d4neee_, d4neeh_, d4neek_
   automated match to d2vgls_

Details for d4neei_

PDB Entry: 4nee, 2.88 Å

PDB Description: crystal structure of AP-2 alpha/simga2 complex bound to HIV-1 Nef

PDB Compounds: (I:) ap-2 complex subunit sigma

SCOPe Domain Sequences for d4neei_:

Sequence; same for both SEQRES and ATOM records:

>d4neei_ d.110.4.2 (I:) Sigma2 adaptin (clathrin coat assembly protein AP17) {Mouse (Mus musculus) [TaxId: 10090]}
mirfiliqnragktrlakwymqfdddekqklieevhavvtvrdakhtnfvefrnfkiiyr
ryaglyfcicvdvndnnlayleaihnfvevlneyfhnvceldlvfnfykvytvvdemfla
geiretsqtkvlkqllmlqsle

Timeline for d4neei_:

• d4neei_ first appeared in SCOPe 2.03
  
• d4neei_ appears in SCOPe 2.04
  
• d4neei_ appears in SCOPe 2.06
  
• d4neei_ appears in the current release, SCOPe 2.08