Lineage for d4n8xv_ (4n8x V:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1540029Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 1542731Superfamily b.40.15: EutN/CcmL-like [159133] (1 family) (S)
    homohexameric unit
  5. 1542732Family b.40.15.1: EutN/CcmL-like [159134] (4 proteins)
    Pfam PF03319
  6. 1542733Protein Carbon dioxide concentrating mechanism protein CcmL [159139] (3 species)
  7. 1542734Species Nostoc sp. [TaxId:103690] [237663] (1 PDB entry)
  8. 1542760Domain d4n8xv_: 4n8x V: [240610]
    automated match to d4n8x3_
    complexed with so4

Details for d4n8xv_

PDB Entry: 4n8x (more details), 1.93 Å

PDB Description: The structure of Nostoc sp. PCC 7120 CcmL
PDB Compounds: (V:) Carbon dioxide concentrating mechanism protein

SCOPe Domain Sequences for d4n8xv_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4n8xv_ b.40.15.1 (V:) Carbon dioxide concentrating mechanism protein CcmL {Nostoc sp. [TaxId: 103690]}
mqiakvrgtvvstqkdpslrgvkllllqlvdeegnllqkyevaadnsvgagfdewvlisr
gsaarqllgneqrpvdaavvaiidtihvedrliyskkd

SCOPe Domain Coordinates for d4n8xv_:

Click to download the PDB-style file with coordinates for d4n8xv_.
(The format of our PDB-style files is described here.)

Timeline for d4n8xv_: