Lineage for d1lob.1 (1lob A:,B:)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1118105Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 1118106Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 1118107Family b.29.1.1: Legume lectins [49900] (5 proteins)
  6. 1118247Protein Legume lectin [49904] (23 species)
  7. 1118376Species Lathyrus ochrus, isolectin I [TaxId:3858] [49910] (7 PDB entries)
  8. 1118379Domain d1lob.1: 1lob A:,B: [24058]
    complexed with ca, mma, mn

Details for d1lob.1

PDB Entry: 1lob (more details), 2 Å

PDB Description: three-dimensional structures of complexes of lathyrus ochrus isolectin i with glucose and mannose: fine specificity of the monosaccharide- binding site
PDB Compounds: (A:) legume isolectin I (alpha chain), (B:) legume isolectin I (beta chain)

SCOPe Domain Sequences for d1lob.1:

Sequence; same for both SEQRES and ATOM records: (download)

>g1lob.1 b.29.1.1 (A:,B:) Legume lectin {Lathyrus ochrus, isolectin I [TaxId: 3858]}
tettsfsitkfgpdqqnlifqgdgyttkerltltkavrntvgralysspihiwdsktgnv
anfvtsftfvidapnsynvadgftffiapvdtkpqtgggylgvfnskdydktsqtvavef
dtfyntawdpsngdrhigidvnsiksintkswalqngkeanvviafnaatnvltvsltyp
Xetsytlnevvplkefvpewvrigfsattgaefaahevlswyfhsela

SCOPe Domain Coordinates for d1lob.1:

Click to download the PDB-style file with coordinates for d1lob.1.
(The format of our PDB-style files is described here.)

Timeline for d1lob.1: