Lineage for d1wbld_ (1wbl D:)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 164500Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
  4. 164501Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (14 families) (S)
  5. 164502Family b.29.1.1: Legume lectins [49900] (4 proteins)
  6. 164615Protein Legume lectin [49904] (20 species)
  7. 164795Species Winged bean (Psophocarpus tetragonolobus), basic agglutinin [TaxId:3891] [49909] (2 PDB entries)
  8. 164801Domain d1wbld_: 1wbl D: [24055]

Details for d1wbld_

PDB Entry: 1wbl (more details), 2.5 Å

PDB Description: winged bean lectin complexed with methyl-alpha-d-galactose

SCOP Domain Sequences for d1wbld_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wbld_ b.29.1.1 (D:) Legume lectin {Winged bean (Psophocarpus tetragonolobus), basic agglutinin}
ktisfnfnqfhqneeqlklqrdarissnsvleltkvvngvptwnstgralyakpvqvwds
ttgnvasfetrfsfsirqpfprphpadglvffiappntqtgegggyfgiynplspypfva
vefdtfrntwdpqiphigidvnsvistktvpftldnggianvvikydastkilhvvlvfp
slgtiytiadivdlkqvlpesvnvgfsaatgdpsgkqrnatethdilswsfsaslpg

SCOP Domain Coordinates for d1wbld_:

Click to download the PDB-style file with coordinates for d1wbld_.
(The format of our PDB-style files is described here.)

Timeline for d1wbld_: