Class b: All beta proteins [48724] (178 folds) |
Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) |
Family b.29.1.1: Legume lectins [49900] (5 proteins) |
Protein Legume lectin [49904] (23 species) |
Species Winged bean (Psophocarpus tetragonolobus), basic agglutinin [TaxId:3891] [49909] (13 PDB entries) |
Domain d1wblb_: 1wbl B: [24053] complexed with amg, ca, mn |
PDB Entry: 1wbl (more details), 2.5 Å
SCOPe Domain Sequences for d1wblb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wblb_ b.29.1.1 (B:) Legume lectin {Winged bean (Psophocarpus tetragonolobus), basic agglutinin [TaxId: 3891]} ktisfnfnqfhqneeqlklqrdarissnsvleltkvvngvptwnstgralyakpvqvwds ttgnvasfetrfsfsirqpfprphpadglvffiappntqtgegggyfgiynplspypfva vefdtfrntwdpqiphigidvnsvistktvpftldnggianvvikydastkilhvvlvfp slgtiytiadivdlkqvlpesvnvgfsaatgdpsgkqrnatethdilswsfsaslpg
Timeline for d1wblb_: