Lineage for d1wblb_ (1wbl B:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2387948Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2387949Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 2387950Family b.29.1.1: Legume lectins [49900] (5 proteins)
  6. 2388157Protein Legume lectin [49904] (23 species)
  7. 2388494Species Winged bean (Psophocarpus tetragonolobus), basic agglutinin [TaxId:3891] [49909] (13 PDB entries)
  8. 2388506Domain d1wblb_: 1wbl B: [24053]
    complexed with amg, ca, mn

Details for d1wblb_

PDB Entry: 1wbl (more details), 2.5 Å

PDB Description: winged bean lectin complexed with methyl-alpha-d-galactose
PDB Compounds: (B:) winged bean lectin

SCOPe Domain Sequences for d1wblb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wblb_ b.29.1.1 (B:) Legume lectin {Winged bean (Psophocarpus tetragonolobus), basic agglutinin [TaxId: 3891]}
ktisfnfnqfhqneeqlklqrdarissnsvleltkvvngvptwnstgralyakpvqvwds
ttgnvasfetrfsfsirqpfprphpadglvffiappntqtgegggyfgiynplspypfva
vefdtfrntwdpqiphigidvnsvistktvpftldnggianvvikydastkilhvvlvfp
slgtiytiadivdlkqvlpesvnvgfsaatgdpsgkqrnatethdilswsfsaslpg

SCOPe Domain Coordinates for d1wblb_:

Click to download the PDB-style file with coordinates for d1wblb_.
(The format of our PDB-style files is described here.)

Timeline for d1wblb_: