SCOPe 2.08: Domain d4ls4b1: 4ls4 B:1-88

Lineage for d4ls4b1 (4ls4 B:1-88)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.298: RelE-like [143010] (1 superfamily)
   beta-alpha(2)-beta(4), 2 layers; a/b, antiparallel beta-sheet; order 15432

4. Superfamily d.298.1: RelE-like [143011] (3 families)
   Toxin component of plasmid stabilisation system

5. Family d.298.1.2: RelE-like [143015] (3 proteins)
   Pfam PF05016

6. Protein automated matches [190809] (2 species)
   not a true protein

7. Species Helicobacter pylori [TaxId:85962] [236600] (3 PDB entries)

8. Domain d4ls4b1: 4ls4 B:1-88 [240502]
   Other proteins in same PDB: d4ls4a2, d4ls4b2
   automated match to d4ls4a_
   complexed with br; mutant

Details for d4ls4b1

PDB Entry: 4ls4, 1.66 Å

PDB Description: Crystal structure of L66S mutant toxin from Helicobacter pylori

PDB Compounds: (B:) Uncharacterized protein, Toxin

SCOPe Domain Sequences for d4ls4b1:

Sequence; same for both SEQRES and ATOM records:

>d4ls4b1 d.298.1.2 (B:1-88) automated matches {Helicobacter pylori [TaxId: 85962]}
mlklnlkksfqkdfdklllngfddsvlneviltlrkkepldpqfqdhalkgkwkpfrech
ikpdvslvylvkddelillrlgshself

Timeline for d4ls4b1:

• d4ls4b1 first appeared in SCOPe 2.04, called d4ls4b_
  
• d4ls4b1 appears in SCOPe 2.07