Lineage for d4ls4a_ (4ls4 A:)
- Root: SCOPe 2.05
Class d: Alpha and beta proteins (a+b) [53931] (381 folds) 
Fold d.298: RelE-like [143010] (1 superfamily)
beta-alpha(2)-beta(4), 2 layers; a/b, antiparallel beta-sheet; order 15432Superfamily d.298.1: RelE-like [143011] (3 families) 
Toxin component of plasmid stabilisation systemFamily d.298.1.2: RelE-like [143015] (3 proteins)
Pfam PF05016Protein automated matches [190809] (2 species)
not a true proteinSpecies Helicobacter pylori [TaxId:85962] [236600] (3 PDB entries) 
Domain d4ls4a_: 4ls4 A: [236602]
automated match to d1z8ma1
complexed with br; mutant
Details for d4ls4a_
PDB Entry: 4ls4 (more details), 1.66 Å
PDB Description: Crystal structure of L66S mutant toxin from Helicobacter pylori
PDB Compounds: (A:) Uncharacterized protein, ToxinSCOPe Domain Sequences for d4ls4a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ls4a_ d.298.1.2 (A:) automated matches {Helicobacter pylori [TaxId: 85962]}
shmlklnlkksfqkdfdklllngfddsvlneviltlrkkepldpqfqdhalkgkwkpfre
chikpdvslvylvkddelillrlgshself
SCOPe Domain Coordinates for d4ls4a_:
Click to download the PDB-style file with coordinates for d4ls4a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d4ls4a_:
- d4ls4a_ first appeared in SCOPe 2.03
- d4ls4a_ appears in SCOPe 2.04
- d4ls4a_ is called d4ls4a1 in SCOPe 2.06
- d4ls4a_ appears in the current release, SCOPe 2.08, called d4ls4a1
View in 3D
