Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.298: RelE-like [143010] (1 superfamily) beta-alpha(2)-beta(4), 2 layers; a/b, antiparallel beta-sheet; order 15432 |
Superfamily d.298.1: RelE-like [143011] (3 families) Toxin component of plasmid stabilisation system |
Family d.298.1.2: RelE-like [143015] (3 proteins) Pfam PF05016 |
Protein automated matches [190809] (2 species) not a true protein |
Species Helicobacter pylori [TaxId:85962] [236600] (3 PDB entries) |
Domain d4ls4a_: 4ls4 A: [236602] automated match to d1z8ma1 complexed with br; mutant |
PDB Entry: 4ls4 (more details), 1.66 Å
SCOPe Domain Sequences for d4ls4a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ls4a_ d.298.1.2 (A:) automated matches {Helicobacter pylori [TaxId: 85962]} shmlklnlkksfqkdfdklllngfddsvlneviltlrkkepldpqfqdhalkgkwkpfre chikpdvslvylvkddelillrlgshself
Timeline for d4ls4a_: