| Class h: Coiled coil proteins [57942] (7 folds) |
| Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies) core: trimeric coiled coil |
Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) ![]() |
| Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins) |
| Protein automated matches [254646] (34 species) not a true protein |
| Species Influenza A virus [TaxId:11320] [255822] (24 PDB entries) |
| Domain d4lkkb_: 4lkk B: [240482] Other proteins in same PDB: d4lkka_ automated match to d1qfub_ complexed with nag; mutant |
PDB Entry: 4lkk (more details), 2.49 Å
SCOPe Domain Sequences for d4lkkb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4lkkb_ h.3.1.1 (B:) automated matches {Influenza A virus [TaxId: 11320]}
lfgaiagfiengweglidgwygfrhqnaqgegtaadykstqsaidqitgklnrliektnq
qfelidnefnevekqignvinwtrdsitevwsynaellvamenqhtidladsemdklyer
vkrqlrenaeedgtgcfeifhkcdddcmasirnntydhskyreeamqn
Timeline for d4lkkb_: