SCOPe 2.06: Domain d1bqp.2: 1bqp C:,D:

Lineage for d1bqp.2 (1bqp C:,D:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families)

5. Family b.29.1.1: Legume lectins [49900] (5 proteins)

6. Protein Legume lectin [49904] (23 species)

7. Species Pea (Pisum sativum) [TaxId:3888] [49905] (6 PDB entries)
   two-chain protein resulted from a single-chain precursor

8. Domain d1bqp.2: 1bqp C:,D: [24029]
   complexed with ca, mn

Details for d1bqp.2

PDB Entry: 1bqp, 2.1 Å

PDB Description: the structure of the pea lectin-d-mannopyranose complex

PDB Compounds: (C:) protein (lectin), (D:) protein (lectin)

SCOPe Domain Sequences for d1bqp.2:

Sequence; same for both SEQRES and ATOM records:

>g1bqp.2 b.29.1.1 (C:,D:) Legume lectin {Pea (Pisum sativum) [TaxId: 3888]}
tettsflitkfspdqqnlifqgdgyttkekltltkavkntvgralysspihiwdretgnv
anfvtsftfvinapnsynvadgftffiapvdtkpqtgggylgvfnsaeydkttqtvavef
dtfynaawdpsnrdrhigidvnsiksvntkswklqngeeanvviafnaatnvltvsltyp
nXvtsytlsdvvslkdvvpewvrigfsattgaeyaahevlswsfhsels

Timeline for d1bqp.2:

• d1bqp.2 first appeared (with stable ids) in SCOP 1.55
  
• d1bqp.2 appears in SCOPe 2.05
  
• d1bqp.2 appears in SCOPe 2.07
  
• d1bqp.2 appears in the current release, SCOPe 2.08