Lineage for d1azdc_ (1azd C:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1307103Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 1307104Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 1307105Family b.29.1.1: Legume lectins [49900] (5 proteins)
  6. 1307109Protein Concanavalin A [49901] (4 species)
    natural circle permutation: the "old" N- and C-termini are linked with a peptide bond, whereas the "new" ones correspond to a cleaved loop
  7. 1307110Species Brazilian jackbean (Canavalia brasiliensis) [TaxId:61861] [49903] (3 PDB entries)
  8. 1307115Domain d1azdc_: 1azd C: [24022]
    complexed with ca, mn

Details for d1azdc_

PDB Entry: 1azd (more details), 3 Å

PDB Description: concanavalin from canavalia brasiliensis
PDB Compounds: (C:) conbr

SCOPe Domain Sequences for d1azdc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1azdc_ b.29.1.1 (C:) Concanavalin A {Brazilian jackbean (Canavalia brasiliensis) [TaxId: 61861]}
adtivaveldtypntdigdpsyphigidiksvrskktakwnmqngkvgtahiiynsvgkr
lsavvsypngdsatvsydvdldnvlpewvrvglsastglyketntilswsftsklksnst
hetnalhfmfnqfskdqkdlilqgdattgtegnlrltrvssngspqgssvgralfyapvh
iwessavvasfeatftflikspdshpadgiaffisnidssipsgstgrllglfpdan

SCOPe Domain Coordinates for d1azdc_:

Click to download the PDB-style file with coordinates for d1azdc_.
(The format of our PDB-style files is described here.)

Timeline for d1azdc_: