![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
![]() | Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) ![]() |
![]() | Family b.29.1.1: Legume lectins [49900] (5 proteins) |
![]() | Protein Concanavalin A [49901] (4 species) natural circle permutation: the "old" N- and C-termini are linked with a peptide bond, whereas the "new" ones correspond to a cleaved loop |
![]() | Species Brazilian jackbean (Canavalia brasiliensis) [TaxId:61861] [49903] (7 PDB entries) |
![]() | Domain d1azdc_: 1azd C: [24022] complexed with ca, mn |
PDB Entry: 1azd (more details), 3 Å
SCOPe Domain Sequences for d1azdc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1azdc_ b.29.1.1 (C:) Concanavalin A {Brazilian jackbean (Canavalia brasiliensis) [TaxId: 61861]} adtivaveldtypntdigdpsyphigidiksvrskktakwnmqngkvgtahiiynsvgkr lsavvsypngdsatvsydvdldnvlpewvrvglsastglyketntilswsftsklksnst hetnalhfmfnqfskdqkdlilqgdattgtegnlrltrvssngspqgssvgralfyapvh iwessavvasfeatftflikspdshpadgiaffisnidssipsgstgrllglfpdan
Timeline for d1azdc_: