Lineage for d4h2hd1 (4h2h D:1-125)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1649013Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. 1649014Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) (S)
  5. 1649263Family d.54.1.0: automated matches [227195] (1 protein)
    not a true family
  6. 1649264Protein automated matches [226922] (67 species)
    not a true protein
  7. 1649582Species Pelagibaca bermudensis [TaxId:314265] [234600] (1 PDB entry)
  8. 1649586Domain d4h2hd1: 4h2h D:1-125 [240179]
    Other proteins in same PDB: d4h2ha2, d4h2hb2, d4h2hc2, d4h2hd2, d4h2he2, d4h2hf2, d4h2hg2, d4h2hh2
    automated match to d4h2ha1
    complexed with 0xw, iod, mg, mpd, ni

Details for d4h2hd1

PDB Entry: 4h2h (more details), 1.7 Å

PDB Description: Crystal structure of an enolase (mandalate racemase subgroup, target EFI-502101) from Pelagibaca bermudensis htcc2601, with bound mg and l-4-hydroxyproline betaine (betonicine)
PDB Compounds: (D:) Mandelate racemase/muconate lactonizing enzyme

SCOPe Domain Sequences for d4h2hd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4h2hd1 d.54.1.0 (D:1-125) automated matches {Pelagibaca bermudensis [TaxId: 314265]}
lkiaeiqlfqhdlpvvngpyriasgdvwsltttivkiiaedgtigwgetcpvgptyaeah
aggalaalevlasglagaealplplhtrmdsllcghnyaksaldiavhdlwgkrlgvpvh
ellgg

SCOPe Domain Coordinates for d4h2hd1:

Click to download the PDB-style file with coordinates for d4h2hd1.
(The format of our PDB-style files is described here.)

Timeline for d4h2hd1: