SCOPe 2.04: Domain d4ee2a2: 4ee2 A:15-225

Lineage for d4ee2a2 (4ee2 A:15-225)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.179: Anthrax protective antigen N-terminal-like [254104] (1 superfamily)
   core: sandwich; 10-12 strands in 2 sheets; jelly roll; may contain inserted subdomains

4. Superfamily b.179.1: PA14-like [254123] (3 families)

5. Family b.179.1.1: PA14 [254147] (2 proteins)
   Pfam PF07691

6. Protein PA14 [254334] (1 species)

7. Species Bacillus anthracis [254763] (14 PDB entries)

8. Domain d4ee2a2: 4ee2 A:15-225 [240098]
   Other proteins in same PDB: d4ee2a1
   complexed with ca; mutant

Details for d4ee2a2

PDB Entry: 4ee2, 1.91 Å

PDB Description: crystal structure of anthrax protective antigen k446m mutant to 1.91-a resolution

PDB Compounds: (A:) Protective antigen

SCOPe Domain Sequences for d4ee2a2:

Sequence; same for both SEQRES and ATOM records:

>d4ee2a2 b.179.1.1 (A:15-225) PA14 {Bacillus anthracis}
ssqgllgyyfsdlnfqapmvvtssttgdlsipsselenipsenqyfqsaiwsgfikvkks
deytfatsadnhvtmwvddqevinkasnsnkirlekgrlyqikiqyqrenptekgldfkl
ywtdsqnkkevissdnlqlpelkqkssnsrkkrstsagptvpdrdndgipdslevegytv
dvknkrtflspwisnihekkgltkyksspek

Timeline for d4ee2a2:

• d4ee2a2 is new in SCOPe 2.04-stable
  
• d4ee2a2 appears in SCOPe 2.05
  
• d4ee2a2 appears in the current release, SCOPe 2.08