Lineage for d4bh1b_ (4bh1 B:)

  1. Root: SCOPe 2.08
  2. 3039230Class h: Coiled coil proteins [57942] (7 folds)
  3. 3040824Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 3040825Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 3040826Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)
  6. 3041482Protein automated matches [254646] (29 species)
    not a true protein
  7. 3041535Species Influenza A virus (a/turkey/turkey/1/2005(h5n1)) [TaxId:375457] [256202] (5 PDB entries)
  8. 3041539Domain d4bh1b_: 4bh1 B: [240023]
    Other proteins in same PDB: d4bh1a_, d4bh1c_, d4bh1e_
    automated match to d2fk0b1
    complexed with nag, po4

Details for d4bh1b_

PDB Entry: 4bh1 (more details), 2.15 Å

PDB Description: h5 (tyty) influenza virus haemagglutinin in complex with avian receptor analogue 3'-sln
PDB Compounds: (B:) Hemagglutinin

SCOPe Domain Sequences for d4bh1b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4bh1b_ h.3.1.1 (B:) automated matches {Influenza A virus (a/turkey/turkey/1/2005(h5n1)) [TaxId: 375457]}
ieggwqgmvdgwygyhhsneqgsgyaadkestqkaidgvtnkvnsiidkmntqfeavgre
fnnlerrienlnkkmedgfldvwtynaellvlmenertldfhdsnvknlydkvrlqlrdn
akelgngcfefyhrcdnecmesvrn

SCOPe Domain Coordinates for d4bh1b_:

Click to download the PDB-style file with coordinates for d4bh1b_.
(The format of our PDB-style files is described here.)

Timeline for d4bh1b_: