Lineage for d4bh1e_ (4bh1 E:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2040266Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 2040267Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 2040314Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 protein domains)
  6. 2040710Protein automated matches [190291] (25 species)
    not a true protein
  7. 2040836Species Influenza a virus [TaxId:375457] [193032] (1 PDB entry)
  8. 2040839Domain d4bh1e_: 4bh1 E: [193041]
    Other proteins in same PDB: d4bh1b_, d4bh1d_, d4bh1f_
    automated match to d2fk0a1
    complexed with nag, po4

Details for d4bh1e_

PDB Entry: 4bh1 (more details), 2.15 Å

PDB Description: H5 (tyTy) Influenza Virus Haemagglutinin in Complex with Avian Receptor Analogue 3'-SLN
PDB Compounds: (E:) Hemagglutinin

SCOPe Domain Sequences for d4bh1e_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4bh1e_ b.19.1.2 (E:) automated matches {Influenza a virus [TaxId: 375457]}
dqicigyhannsteqvdtimeknvtvthaqdilekthngklcdldgvkplilrdcsvagw
llgnpmcdeflnvpewsyivekinpandlcypgnfndyeelkhllsrinhfekiqiipks
swsdheasagvssacpyqgrssffrnvvwlikkdnayptikrsynntnqedllvlwgihh
pndaaeqtrlyqnpttyisvgtstlnqrlvpkiatrskvngqsgrmeffwtilkpndain
fesngnfiapenaykivkkgdstimkseleygncntkcqtpigainssmpfhnihpltig
ecpkyvkssrlvlatglrn

SCOPe Domain Coordinates for d4bh1e_:

Click to download the PDB-style file with coordinates for d4bh1e_.
(The format of our PDB-style files is described here.)

Timeline for d4bh1e_: