Lineage for d4b5cb_ (4b5c B:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2565345Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 2567239Superfamily d.79.7: OmpA-like [103088] (2 families) (S)
  5. 2567265Family d.79.7.0: automated matches [195454] (1 protein)
    not a true family
  6. 2567266Protein automated matches [195455] (13 species)
    not a true protein
  7. 2567320Species Burkholderia pseudomallei [TaxId:28450] [234123] (1 PDB entry)
  8. 2567322Domain d4b5cb_: 4b5c B: [240004]
    automated match to d4b5ca_
    complexed with act

Details for d4b5cb_

PDB Entry: 4b5c (more details), 2.3 Å

PDB Description: crystal structure of the peptidoglycan-associated lipoprotein from burkholderia pseudomallei
PDB Compounds: (B:) putative ompa family lipoprotein

SCOPe Domain Sequences for d4b5cb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4b5cb_ d.79.7.0 (B:) automated matches {Burkholderia pseudomallei [TaxId: 28450]}
tvdplndpnsplakrsvyfdfdsysvqdqyqallqqhaqylkshpqrhiliqgntdergt
seynlalgqkraeavrralsllgvgdaqmeavslgkekpvalghdeaswaqnrradlvyq

SCOPe Domain Coordinates for d4b5cb_:

Click to download the PDB-style file with coordinates for d4b5cb_.
(The format of our PDB-style files is described here.)

Timeline for d4b5cb_: