Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) division into families based on beta-sheet topologies |
Family c.37.1.12: ABC transporter ATPase domain-like [52686] (25 proteins) there are two additional subdomains inserted into the central core that has a RecA-like topology |
Protein automated matches [190723] (8 species) not a true protein |
Species Escherichia coli K-12 [TaxId:83333] [233742] (1 PDB entry) |
Domain d3tuic1: 3tui C:1-240 [239832] Other proteins in same PDB: d3tuia_, d3tuib_, d3tuic2, d3tuic3, d3tuid2, d3tuie_, d3tuif_, d3tuig2, d3tuih2, d3tuih3 automated match to d3tuid1 complexed with adp |
PDB Entry: 3tui (more details), 2.9 Å
SCOPe Domain Sequences for d3tuic1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3tuic1 c.37.1.12 (C:1-240) automated matches {Escherichia coli K-12 [TaxId: 83333]} miklsnitkvfhqgtrtiqalnnvslhvpagqiygvigasgagkstlircvnllerpteg svlvdgqelttlseseltkarrqigmifqhfnllssrtvfgnvalpleldntpkdevkrr vtellslvglgdkhdsypsnlsggqkqrvaiaralasnpkvllcdqatsaldpattrsil ellkdinrrlgltillithemdvvkricdcvavisngelieqdtvsevfshpktplaqkf
Timeline for d3tuic1: