Lineage for d3spue_ (3spu E:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2996664Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
    duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets
  4. 2996665Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (16 families) (S)
  5. 2997604Family d.157.1.0: automated matches [191360] (1 protein)
    not a true family
  6. 2997605Protein automated matches [190418] (31 species)
    not a true protein
  7. 2997710Species Klebsiella pneumoniae [TaxId:573] [189718] (103 PDB entries)
  8. 2997876Domain d3spue_: 3spu E: [239732]
    Other proteins in same PDB: d3spua2, d3spuc2, d3spud2
    automated match to d3spua_
    complexed with zn

Details for d3spue_

PDB Entry: 3spu (more details), 2.1 Å

PDB Description: apo ndm-1 crystal structure
PDB Compounds: (E:) Beta-lactamase NDM-1

SCOPe Domain Sequences for d3spue_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3spue_ d.157.1.0 (E:) automated matches {Klebsiella pneumoniae [TaxId: 573]}
dqrfgdlvfrqlapnvwqhtsyldmpgfgavasnglivrdggrvlvvdtawtddqtaqil
nwikqeinlpvalavvthahqdkmggmdalhaagiatyanalsnqlapqegmvaaqhslt
faangwvepatapnfgplkvfypgpghtsdnitvgidgtdiafggclikdskakslgnlg
dadtehyaasarafgaafpkasmivmshsapdsraaithtarmadkl

SCOPe Domain Coordinates for d3spue_:

Click to download the PDB-style file with coordinates for d3spue_.
(The format of our PDB-style files is described here.)

Timeline for d3spue_: