Lineage for d3sdip_ (3sdi P:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1676433Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 1676434Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 1676603Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 1678261Protein automated matches [190144] (7 species)
    not a true protein
  7. 1678524Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (31 PDB entries)
  8. 1678567Domain d3sdip_: 3sdi P: [239718]
    Other proteins in same PDB: d3sdi1_, d3sdi2_, d3sdia_, d3sdic_, d3sdie_, d3sdif_, d3sdig_, d3sdih_, d3sdii_, d3sdij_, d3sdik_, d3sdil_, d3sdim_, d3sdin_, d3sdio_, d3sdiq_, d3sdis_, d3sdit_, d3sdiu_, d3sdiv_, d3sdiw_, d3sdix_, d3sdiy_, d3sdiz_
    automated match to d3oeub_
    complexed with 3sd, mes, mg

Details for d3sdip_

PDB Entry: 3sdi (more details), 2.65 Å

PDB Description: structure of yeast 20s open-gate proteasome with compound 20
PDB Compounds: (P:) Proteasome component Y13

SCOPe Domain Sequences for d3sdip_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3sdip_ d.153.1.4 (P:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
tifspegrlyqveyalesishagtaigimasdgivlaaerkvtstlleqdtsteklykln
dkiavavagltadaeilintarihaqnylktynedipveilvrrlsdikqgytqhgglrp
fgvsfiyagyddrygyqlytsnpsgnytgwkaisvgantsaaqtllqmdykddmkvddai
elalktlskttdssaltydrlefatirkgandgevyqkifkpqeikdilvktgit

SCOPe Domain Coordinates for d3sdip_:

Click to download the PDB-style file with coordinates for d3sdip_.
(The format of our PDB-style files is described here.)

Timeline for d3sdip_: