Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) N-terminal residue provides two catalytic groups, nucleophile and proton donor |
Family d.153.1.4: Proteasome subunits [56251] (4 proteins) |
Protein automated matches [190144] (7 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (31 PDB entries) |
Domain d3sdip_: 3sdi P: [239718] Other proteins in same PDB: d3sdi1_, d3sdi2_, d3sdia_, d3sdic_, d3sdie_, d3sdif_, d3sdig_, d3sdih_, d3sdii_, d3sdij_, d3sdik_, d3sdil_, d3sdim_, d3sdin_, d3sdio_, d3sdiq_, d3sdis_, d3sdit_, d3sdiu_, d3sdiv_, d3sdiw_, d3sdix_, d3sdiy_, d3sdiz_ automated match to d3oeub_ complexed with 3sd, mes, mg |
PDB Entry: 3sdi (more details), 2.65 Å
SCOPe Domain Sequences for d3sdip_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3sdip_ d.153.1.4 (P:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]} tifspegrlyqveyalesishagtaigimasdgivlaaerkvtstlleqdtsteklykln dkiavavagltadaeilintarihaqnylktynedipveilvrrlsdikqgytqhgglrp fgvsfiyagyddrygyqlytsnpsgnytgwkaisvgantsaaqtllqmdykddmkvddai elalktlskttdssaltydrlefatirkgandgevyqkifkpqeikdilvktgit
Timeline for d3sdip_:
View in 3D Domains from other chains: (mouse over for more information) d3sdi1_, d3sdi2_, d3sdia_, d3sdib_, d3sdic_, d3sdid_, d3sdie_, d3sdif_, d3sdig_, d3sdih_, d3sdii_, d3sdij_, d3sdik_, d3sdil_, d3sdim_, d3sdin_, d3sdio_, d3sdiq_, d3sdir_, d3sdis_, d3sdit_, d3sdiu_, d3sdiv_, d3sdiw_, d3sdix_, d3sdiy_, d3sdiz_ |