SCOPe 2.06: Domain d3qore1: 3qor E:158-274

Lineage for d3qore1 (3qor E:158-274)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.15: HSP20-like chaperones [49763] (1 superfamily)
   sandwich; 8 strands in 2 sheets; greek-key

4. Superfamily b.15.1: HSP20-like chaperones [49764] (5 families)

5. Family b.15.1.0: automated matches [191643] (1 protein)
   not a true family

6. Protein automated matches [191181] (7 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [233346] (1 PDB entry)

8. Domain d3qore1: 3qor E:158-274 [239643]
   Other proteins in same PDB: d3qora2, d3qorb2, d3qorc2, d3qord2, d3qore2
   automated match to d3qora_
   complexed with act

Details for d3qore1

PDB Entry: 3qor, 1.75 Å

PDB Description: Crystal structure of human nuclear migration protein NudC

PDB Compounds: (E:) Nuclear migration protein nudC

SCOPe Domain Sequences for d3qore1:

Sequence; same for both SEQRES and ATOM records:

>d3qore1 b.15.1.0 (E:158-274) automated matches {Human (Homo sapiens) [TaxId: 9606]}
klkpnlgngadlpnyrwtqtlseldlavpfcvnfrlkgkdmvvdiqrrhlrvglkgqpai
idgelynevkveesswliadgavvtvhlekinkmewwsrlvssdpeintkkinpens

Timeline for d3qore1:

• d3qore1 first appeared in SCOPe 2.04, called d3qore_
  
• d3qore1 was called d3qore_ in SCOPe 2.05
  
• d3qore1 appears in SCOPe 2.07
  
• d3qore1 appears in the current release, SCOPe 2.08