Lineage for d3qorb1 (3qor B:158-273)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2773837Fold b.15: HSP20-like chaperones [49763] (1 superfamily)
    sandwich; 8 strands in 2 sheets; greek-key
  4. 2773838Superfamily b.15.1: HSP20-like chaperones [49764] (5 families) (S)
  5. 2773941Family b.15.1.0: automated matches [191643] (1 protein)
    not a true family
  6. 2773942Protein automated matches [191181] (10 species)
    not a true protein
  7. 2773945Species Human (Homo sapiens) [TaxId:9606] [233346] (1 PDB entry)
  8. 2773947Domain d3qorb1: 3qor B:158-273 [239640]
    Other proteins in same PDB: d3qora2, d3qorb2, d3qorc2, d3qord2, d3qore2
    automated match to d3qora_
    complexed with act

Details for d3qorb1

PDB Entry: 3qor (more details), 1.75 Å

PDB Description: Crystal structure of human nuclear migration protein NudC
PDB Compounds: (B:) Nuclear migration protein nudC

SCOPe Domain Sequences for d3qorb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3qorb1 b.15.1.0 (B:158-273) automated matches {Human (Homo sapiens) [TaxId: 9606]}
klkpnlgngadlpnyrwtqtlseldlavpfcvnfrlkgkdmvvdiqrrhlrvglkgqpai
idgelynevkveesswliadgavvtvhlekinkmewwsrlvssdpeintkkinpen

SCOPe Domain Coordinates for d3qorb1:

Click to download the PDB-style file with coordinates for d3qorb1.
(The format of our PDB-style files is described here.)

Timeline for d3qorb1: